Recombinant Human MTMR12 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MTMR12 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 648-747 of Human MTMR12 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PEAQILGGGQVATLSKLLEMMEEVQSLQEKIDERHHSQQAPQAEAPCLLRNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGDV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MTMR12

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MTMR12 Protein

  • 3-PAP3PAP
  • 3-phosphatase adapter subunit
  • KIAA1682FLJ20476
  • myotubularin related protein 12
  • myotubularin-related protein 12,3-phosphatase adapter protein
  • Phosphatidylinositol-3 phosphate 3-phosphatase adapter subunit
  • phosphatidylinositol-3 phosphate 3-phosphatase adaptor subunit
  • phosphatidylinositol-3-phosphate associated protein
  • PIP3AP

Background

MTMR12 - myotubularin related protein 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86113
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-56548
Species: Hu
Applications: ICC/IF
NBP2-33580
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-46403
Species: Hu
Applications: IHC
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-88447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31365
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80601
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
MAB7670
Species: Hu
Applications: WB, ICC
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF2715
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00054545-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MTMR12 Partial Recombinant Protein (H00054545-Q01) (0)

There are no publications for MTMR12 Partial Recombinant Protein (H00054545-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTMR12 Partial Recombinant Protein (H00054545-Q01) (0)

There are no reviews for MTMR12 Partial Recombinant Protein (H00054545-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTMR12 Partial Recombinant Protein (H00054545-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MTMR12 Products

Bioinformatics Tool for MTMR12 Partial Recombinant Protein (H00054545-Q01)

Discover related pathways, diseases and genes to MTMR12 Partial Recombinant Protein (H00054545-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTMR12 Partial Recombinant Protein (H00054545-Q01)

Discover more about diseases related to MTMR12 Partial Recombinant Protein (H00054545-Q01).
 

Pathways for MTMR12 Partial Recombinant Protein (H00054545-Q01)

View related products by pathway.

PTMs for MTMR12 Partial Recombinant Protein (H00054545-Q01)

Learn more about PTMs related to MTMR12 Partial Recombinant Protein (H00054545-Q01).
 

Research Areas for MTMR12 Partial Recombinant Protein (H00054545-Q01)

Find related products by research area.

Blogs on MTMR12

There are no specific blogs for MTMR12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MTMR12 Antibody
NBP2-19432

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MTMR12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MTMR12