MTCO1 Antibody

Images

 
Western Blot: MTCO1 Antibody [NBP2-83236] - Host: Rabbit. Target Name: MT-CO1. Sample Tissue: Human Hela Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTCO1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human MTCO1. Peptide sequence: SLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
COX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MTCO1 Antibody

  • COI
  • COX1
  • MTCO1
  • MT-COI mitochondrially encoded cytochrome c oxidase I
  • MT-COI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-85500
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-32550
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00001351-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-94462
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83180
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92639
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-05606
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-47365
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-71648
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, KO, Simple Western, WB
NBP2-83236
Species: Hu
Applications: WB

Publications for MTCO1 Antibody (NBP2-83236) (0)

There are no publications for MTCO1 Antibody (NBP2-83236).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTCO1 Antibody (NBP2-83236) (0)

There are no reviews for MTCO1 Antibody (NBP2-83236). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTCO1 Antibody (NBP2-83236) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTCO1 Products

Array NBP2-83236

Bioinformatics Tool for MTCO1 Antibody (NBP2-83236)

Discover related pathways, diseases and genes to MTCO1 Antibody (NBP2-83236). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTCO1 Antibody (NBP2-83236)

Discover more about diseases related to MTCO1 Antibody (NBP2-83236).
 

Pathways for MTCO1 Antibody (NBP2-83236)

View related products by pathway.

PTMs for MTCO1 Antibody (NBP2-83236)

Learn more about PTMs related to MTCO1 Antibody (NBP2-83236).
 

Research Areas for MTCO1 Antibody (NBP2-83236)

Find related products by research area.

Blogs on MTCO1

There are no specific blogs for MTCO1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTCO1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COX1