Recombinant Human MSH5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MSH5 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 736 - 835 of Human MSH5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIKPVKDLLKKNQMENCQTLVDKFMKLDLEDPNLDLNVFMSQEVLPAATSIL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MSH5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MSH5 Protein

  • DKFZp434C1615
  • G7
  • hMSH5
  • MGC2939
  • mutS (E. coli) homolog 5
  • mutS homolog 5 (E. coli)
  • mutS protein homolog 5
  • MUTSH5
  • NG23

Background

MSH5 - mutS homolog 5 (E. coli)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58170
Species: Hu
Applications: WB
H00001192-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
30230002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-56552
Species: Hu
Applications: WB
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-58172
Species: Hu
Applications: WB
NBP1-84010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-329
Species: Hu
Applications: WB, IHC, IP, PLA, RIA
NB100-56516
Species: Hu, Mu
Applications: WB, IHC
NBP2-55958
Species: Hu
Applications: ICC/IF
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004535-Q01
Species: Hu
NBP2-33955
Species: Hu
Applications: WB, IHC, IHC-P
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-88930
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88929
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MSH5 Partial Recombinant Protein (H00004439-Q01) (0)

There are no publications for MSH5 Partial Recombinant Protein (H00004439-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSH5 Partial Recombinant Protein (H00004439-Q01) (0)

There are no reviews for MSH5 Partial Recombinant Protein (H00004439-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MSH5 Partial Recombinant Protein (H00004439-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MSH5 Products

Bioinformatics Tool for MSH5 Partial Recombinant Protein (H00004439-Q01)

Discover related pathways, diseases and genes to MSH5 Partial Recombinant Protein (H00004439-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSH5 Partial Recombinant Protein (H00004439-Q01)

Discover more about diseases related to MSH5 Partial Recombinant Protein (H00004439-Q01).
 

Pathways for MSH5 Partial Recombinant Protein (H00004439-Q01)

View related products by pathway.

PTMs for MSH5 Partial Recombinant Protein (H00004439-Q01)

Learn more about PTMs related to MSH5 Partial Recombinant Protein (H00004439-Q01).
 

Research Areas for MSH5 Partial Recombinant Protein (H00004439-Q01)

Find related products by research area.

Blogs on MSH5

There are no specific blogs for MSH5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF
MSH5 Antibody
NBP2-57274

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MSH5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MSH5