MSH5 Antibody - BSA Free

Western Blot: MSH5 Antibody [NBP2-57274] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: MSH5 Antibody [NBP2-57274] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum & vesicles.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MSH5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MSH5 Antibody - BSA Free (NBP2-57274) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: METCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIKPVKDLLK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MSH5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MSH5 Recombinant Protein Antigen (NBP2-57274PEP)

Reactivity Notes

Mouse 83%, Rat 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MSH5 Antibody - BSA Free

• DKFZp434C1615
• G7
• hMSH5
• MGC2939
• mutS (E. coli) homolog 5
• mutS homolog 5 (E. coli)
• mutS protein homolog 5
• MUTSH5
• NG23

Background

MSH5 encodes a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over. This protein forms heterooligomers with another member of this family, mutS homolog 4. Alternative splicing results in four transcript variants encoding three different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MSH5