MRPS27 Antibody

Western Blot: MRPS27 Antibody [H00023107-B01P] - Analysis of MRPS27 expression in human kidney.

Immunocytochemistry/Immunofluorescence: MRPS27 Antibody [H00023107-B01P] - Analysis of purified antibody to MRPS27 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: MRPS27 Antibody [H00023107-B01P] - Analysis of MRPS27 expression in transfected 293T cell line by MRPS27 polyclonal antibody. Lane 1: MRPS27 transfected lysate(18.48 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

MRPS27 Antibody Summary

• Immunogen: MRPS27 (AAH30521.1, 1 a.a. - 168 a.a.) full-length human protein. MPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA
• Specificity: MRPS27 - mitochondrial ribosomal protein S27,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: MRPS27
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MRPS27 Antibody

• FLJ21764
• KIAA0264FLJ23348
• mitochondrial ribosomal protein S27
• mitochondrial
• MRP-S27

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that may be a functional partner of the death associated protein 3 (DAP3). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRPS27 Antibody (H00023107-B01P)(1)

Publication using H00023107-B01P

• Tang T, Zheng B, Chen SH et al. hNOA1 interacts with complex I and DAP3 and regulates mitochondrial respiration and apoptosis. J Biol Chem 2009-02-20 [PMID: 19103604]

Bioinformatics

• Gene Symbol: MRPS27
• Entrez:
  • 23107(Human)
• Uniprot:
  • AAH30521.1(Human)