MRPS18A Antibody

Images

 
Western Blot: MRPS18A Antibody [NBP1-83849] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: MRPS18A Antibody [NBP1-83849] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPS18A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PSELQRELQRLSPLPRHSGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS18A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRPS18A Protein (NBP1-83849PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPS18A Antibody

  • 28S ribosomal protein S18a, mitochondrial
  • FLJ10548
  • mitochondrial ribosomal protein S18-3
  • mitochondrial ribosomal protein S18A
  • mitochondrial
  • MRP-S18-3
  • MRPS18-3HumanS18b
  • Mrps18a
  • MRP-S18-a
  • S18bmt
  • S18mt-a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47624
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57713
Species: Hu
Applications: WB, ICC/IF
NBP1-77101
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31703
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001937-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-45910
Species: Hu
Applications: WB, IHC
NBP1-87212
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02028
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for MRPS18A Antibody (NBP1-83849) (0)

There are no publications for MRPS18A Antibody (NBP1-83849).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS18A Antibody (NBP1-83849) (0)

There are no reviews for MRPS18A Antibody (NBP1-83849). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS18A Antibody (NBP1-83849) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPS18A Products

Bioinformatics Tool for MRPS18A Antibody (NBP1-83849)

Discover related pathways, diseases and genes to MRPS18A Antibody (NBP1-83849). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS18A Antibody (NBP1-83849)

Discover more about diseases related to MRPS18A Antibody (NBP1-83849).
 

Pathways for MRPS18A Antibody (NBP1-83849)

View related products by pathway.

Blogs on MRPS18A

There are no specific blogs for MRPS18A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS18A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS18A