Recombinant Human MRPS17 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MRPS17 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-130 of Human MRPS17 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
MRPS17
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MRPS17 Protein

  • mitochondrial ribosomal protein S17
  • MRP-S1728S ribosomal protein S17, mitochondrial
  • RPMS17HSPC011
  • S17mt

Background

MRPS17( AAH54031, 1 a.a. - 131 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-88567
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81685
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81032
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83651
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82620
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-82786
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33587
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00065008-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
H00006218-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P

Publications for MRPS17 Recombinant Protein (H00051373-P01) (0)

There are no publications for MRPS17 Recombinant Protein (H00051373-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS17 Recombinant Protein (H00051373-P01) (0)

There are no reviews for MRPS17 Recombinant Protein (H00051373-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS17 Recombinant Protein (H00051373-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRPS17 Products

Bioinformatics Tool for MRPS17 Recombinant Protein (H00051373-P01)

Discover related pathways, diseases and genes to MRPS17 Recombinant Protein (H00051373-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for MRPS17 Recombinant Protein (H00051373-P01)

View related products by pathway.

Research Areas for MRPS17 Recombinant Protein (H00051373-P01)

Find related products by research area.

Blogs on MRPS17

There are no specific blogs for MRPS17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ENO3 Antibody (5D1)
H00002027-M01
MRPS17 Antibody
NBP2-13623

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MRPS17 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS17