MRPL37 Antibody


Western Blot: MRPL37 Antibody [NBP1-82621] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-82621] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

MRPL37 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:SATWNRESLLLQVRGSGGARLSTKDPLPTIASREEIEATKNHVLETFYPISPIIDLHECNIYDVK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRPL37 Protein (NBP1-82621PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MRPL37 Antibody

  • 39S ribosomal protein L2, mitochondrial
  • L2mt
  • L37mt
  • MGC878
  • mitochondrial ribosomal protein L37
  • MRP-L37
  • ribosomal protein, mitochondrial, L2
  • RPML239S ribosomal protein L37, mitochondrial


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MRPL37 Antibody (NBP1-82621) (0)

There are no publications for MRPL37 Antibody (NBP1-82621).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL37 Antibody (NBP1-82621) (0)

There are no reviews for MRPL37 Antibody (NBP1-82621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPL37 Antibody (NBP1-82621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MRPL37 Products

Bioinformatics Tool for MRPL37 Antibody (NBP1-82621)

Discover related pathways, diseases and genes to MRPL37 Antibody (NBP1-82621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPL37 Antibody (NBP1-82621)

Discover more about diseases related to MRPL37 Antibody (NBP1-82621).

Pathways for MRPL37 Antibody (NBP1-82621)

View related products by pathway.

Research Areas for MRPL37 Antibody (NBP1-82621)

Find related products by research area.

Blogs on MRPL37

There are no specific blogs for MRPL37, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MRPL37 Antibody and receive a gift card or discount.


Gene Symbol MRPL37