MRPS14 Antibody - BSA Free

Western Blot: MRPS14 Antibody [NBP2-13622] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunocytochemistry/Immunofluorescence: MRPS14 Antibody [NBP2-13622] - Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear membrane & mitochondria.

Immunohistochemistry-Paraffin: MRPS14 Antibody [NBP2-13622] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Staining of human Pancreas shows moderate granular cytoplasmic positivity in islets of Langerhans and exocrine glandular cells.

Staining of human Duodenum shows strong granular cytoplasmic positivity in glandular cells.

Staining of human Heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

Staining of human Kidney shows strong granular cytoplasmic positivity in cells in tubules.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPS14 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRPS14 Antibody - BSA Free (NBP2-13622) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: YADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPS14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  MRPS14 Protein (NBP2-13622PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MRPS14 Antibody - BSA Free

• DJ262D12.2
• HSMRPS14
• mitochondrial 28S ribosomal protein S14
• mitochondrial ribosomal protein S14,28S ribosomal protein S14, mitochondrial
• MRP-S14
• S14mt

Background

MRPS14, or Mitochondrial Ribosomal Protein S14, consists of a 128 amino acid isoform that is 15 kDa, and is a portion of the 28S mitochondrial ribosome subunit that aids in protein synthesis. Research is not currently being conducted on the relationship between MRPS14 and any diseases or disorders. MRPS14 interacts with ICT1, DDX56, USP42, MAP1LC3A, and MRPS2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS14