We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MRPS14 Antibody - BSA Free

Images

 
Western Blot: MRPS14 Antibody [NBP2-13622] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: MRPS14 Antibody [NBP2-13622] - Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear membrane & mitochondria.
Immunohistochemistry-Paraffin: MRPS14 Antibody [NBP2-13622] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
Staining of human Pancreas shows moderate granular cytoplasmic positivity in islets of Langerhans and exocrine glandular cells.
Staining of human Duodenum shows strong granular cytoplasmic positivity in glandular cells.
Staining of human Heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
Staining of human Kidney shows strong granular cytoplasmic positivity in cells in tubules.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

MRPS14 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: YADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS14
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
MRPS14 Protein (NBP2-13622PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MRPS14 Antibody - BSA Free

  • DJ262D12.2
  • HSMRPS14
  • mitochondrial 28S ribosomal protein S14
  • mitochondrial ribosomal protein S14,28S ribosomal protein S14, mitochondrial
  • MRP-S14
  • S14mt

Background

MRPS14, or Mitochondrial Ribosomal Protein S14, consists of a 128 amino acid isoform that is 15 kDa, and is a portion of the 28S mitochondrial ribosome subunit that aids in protein synthesis. Research is not currently being conducted on the relationship between MRPS14 and any diseases or disorders. MRPS14 interacts with ICT1, DDX56, USP42, MAP1LC3A, and MRPS2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84847
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81290
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-83254
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87069
Species: Hu, Mu
Applications: ICC/IF,  IHC-P, KD, Simple Western, WB
NBP3-13522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13622
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for MRPS14 Antibody (NBP2-13622) (0)

There are no publications for MRPS14 Antibody (NBP2-13622).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS14 Antibody (NBP2-13622) (0)

There are no reviews for MRPS14 Antibody (NBP2-13622). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRPS14 Antibody (NBP2-13622) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPS14 Products

Research Areas for MRPS14 Antibody (NBP2-13622)

Find related products by research area.

Blogs on MRPS14

There are no specific blogs for MRPS14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS14 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS14