MRPL43 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit MRPL43 Antibody - BSA Free (NBP2-84173) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region MRPL43. Peptide sequence: WHPFTNKPTTFRGLRPREVQDPAPAQDTGLRLSAVAPQILLPGWPDPPDL The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MRPL43 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for MRPL43 Antibody - BSA Free
Background
MRPL43, also known as Mitochondrial Ribosomal Protein L43, contains several isoforms that are 23 kDa, 22 kDa, 18 kDa, and 17 kDa, and has been associated with protein synthesis in the mitochondria, though its specific function is still unknown. Current research is being conducted on MRPL43 and its connection to several diseases and disorders, including chronic progressive external ophthalmoplegia, prostatitis, Alzheimer's disease, and paraplegia. The protein interacts with ICT1, ARRB2, EIF1B, DDX56, and AARS2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Publications for MRPL43 Antibody (NBP2-84173) (0)
There are no publications for MRPL43 Antibody (NBP2-84173).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MRPL43 Antibody (NBP2-84173) (0)
There are no reviews for MRPL43 Antibody (NBP2-84173).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MRPL43 Antibody (NBP2-84173) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MRPL43 Products
Blogs on MRPL43