MRPL42 Antibody - Azide and BSA Free Summary
| Immunogen |
MRPL42 (NP_054769.1, 1 a.a. - 142 a.a.) full-length human protein. MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MRPL42 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for Western Blot, Functional |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for MRPL42 Antibody - Azide and BSA Free
Background
MRPL42, or Mitochondrial Ribosomal Protein L42, consists of a 142 amino acid isoform that is 17 kDa, and is involved in mitochondrial protein synthesis. There is no current research being conducted based on the relationship between MRPL42 and any diseases or disorders. The protein is linked to the process of translation, and interacts with IKBKAP, EEF1A1, EGFR, MRPS21, and MRPS36.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pr, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Dr, Hu, Mu
Applications: IP, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Publications for MRPL42 Antibody (H00028977-D01P) (0)
There are no publications for MRPL42 Antibody (H00028977-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MRPL42 Antibody (H00028977-D01P) (0)
There are no reviews for MRPL42 Antibody (H00028977-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MRPL42 Antibody (H00028977-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MRPL42 Products
Research Areas for MRPL42 Antibody (H00028977-D01P)
Find related products by research area.
|
Blogs on MRPL42