MRPL34 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MRPL34 Antibody [NBP2-13616] - Staining of human cell line HEK 293 shows localization to nucleoplasm & nuclear bodies.

Immunohistochemistry-Paraffin: MRPL34 Antibody [NBP2-13616] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferus ducts.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPL34 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: AALLGGRWLQPRAWLGFPDAWGLPTPQQARGKARGNEYQPSNIKRKNKHGWVRRLSTPAGVQVILRRMLKGRKSLSH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL34
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MRPL34 Protein (NBP2-13616PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPL34 Antibody - BSA Free

• L34mtMGC24974
• MGC2633
• mitochondrial ribosomal protein L34
• MRP-L34,39S ribosomal protein L34, mitochondrial

Background

MRPL34, also known as 39 S ribosomal protein L34, mitochondrial, is a 10.2 kDa, 92 amino acid protein that is involved in mitochondrial protein synthesis as a member of the ribosomal protein L34P family. Currently, there is no research linking this protein to any diseases. The protein interacts with MRPL2, MRPL24, MRPL11, MRPL13, and MRPL22.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPL34