MPPED1 Antibody

Images

 
Western Blot: MPPED1 Antibody [H00000758-B01P] - Analysis of MPPED1 expression in transfected 293T cell line by MPPED1 polyclonal antibody. Lane1:MPPED1 transfected lysate(35.97 KDa). Lane 2:Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MPPED1 Antibody Summary

Immunogen
MPPED1 (AAH28035, 1 a.a. - 326 a.a.) full-length human protein. MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS
Specificity
MPPED1 - metallophosphoesterase domain containing 1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MPPED1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MPPED1 Antibody

  • Adult brain protein 239
  • C22orf1MGC88045
  • chromosome 22 open reading frame 1
  • EC 3.1
  • FAM1AFLJ78907
  • FLJ50009
  • FLJ54633,239ABFLJ59965
  • metallophosphoesterase domain containing 1
  • metallophosphoesterase domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
AF2940
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
AF2180
Species: Hu
Applications: WB, Simple Western, IP
H00000758-B01P
Species: Hu
Applications: WB

Publications for MPPED1 Antibody (H00000758-B01P) (0)

There are no publications for MPPED1 Antibody (H00000758-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPPED1 Antibody (H00000758-B01P) (0)

There are no reviews for MPPED1 Antibody (H00000758-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MPPED1 Antibody (H00000758-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MPPED1 Products

Bioinformatics Tool for MPPED1 Antibody (H00000758-B01P)

Discover related pathways, diseases and genes to MPPED1 Antibody (H00000758-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPPED1 Antibody (H00000758-B01P)

Discover more about diseases related to MPPED1 Antibody (H00000758-B01P).
 

Pathways for MPPED1 Antibody (H00000758-B01P)

View related products by pathway.

Blogs on MPPED1

There are no specific blogs for MPPED1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPPED1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPPED1
Entrez
Uniprot