Methionine Sulfoxide Reductase B Recombinant Protein Antigen

Images

 
There are currently no images for Methionine Sulfoxide Reductase B Recombinant Protein Antigen (NBP2-57316PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Methionine Sulfoxide Reductase B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Methionine Sulfoxide Reductase B.

Source: E. coli

Amino Acid Sequence: PGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVRGHRGGGGTGAARESREPVPPSSLCLPHSSRGLEASIPGLLPLPGSCH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MSRB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57316.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Methionine Sulfoxide Reductase B Recombinant Protein Antigen

  • EC 1.8.4.-
  • methionine sulfoxide reductase
  • methionine-R-sulfoxide reductase B1
  • MGC3344
  • MsrB1
  • MSRB1selenoprotein R
  • Selenoprotein X
  • selenoprotein X, 1
  • SELR
  • SELX

Background

Methionine Sulfoxide Reductase B encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein belongs to the methionine sulfoxide reductase B (MsrB) family, and it is expressed in a variety of adult and fetal tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86594
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-38255
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-84259
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-45606
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
NBP1-86120
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90979
Species: Hu
Applications: IHC,  IHC-P
NBP3-32740
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
MAB7428
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
NBP1-86919
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-13731
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-57749
Species: Hu
Applications: IHC,  IHC-P, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB5457
Species: Hu, Mu, Rt
Applications: WB

Publications for Methionine Sulfoxide Reductase B Recombinant Protein Antigen (NBP2-57316PEP) (0)

There are no publications for Methionine Sulfoxide Reductase B Recombinant Protein Antigen (NBP2-57316PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Methionine Sulfoxide Reductase B Recombinant Protein Antigen (NBP2-57316PEP) (0)

There are no reviews for Methionine Sulfoxide Reductase B Recombinant Protein Antigen (NBP2-57316PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Methionine Sulfoxide Reductase B Recombinant Protein Antigen (NBP2-57316PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Methionine Sulfoxide Reductase B Products

Research Areas for Methionine Sulfoxide Reductase B Recombinant Protein Antigen (NBP2-57316PEP)

Find related products by research area.

Blogs on Methionine Sulfoxide Reductase B

There are no specific blogs for Methionine Sulfoxide Reductase B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Methionine Sulfoxide Reductase B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MSRB1