MAGED4B Antibody

Images

 
Western Blot: MAGED4B Antibody [NBP1-89594] - Analysis in control (vector only transfected HEK293T lysate) and mAGED4B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: MAGED4B Antibody [NBP1-89594] - Staining of human heart muscle shows strong membranous and cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAGED4B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AEGSFSVQSESYSVEDMDEGSDEVGEEEMVEGNDYEEFGAFGGYGTLTSFDIHILRAFGSLGPGLRILSNEPWELENPVLAQTLVEALQLDPETLANETAARAANVARAAASNRAA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGED4B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MAGED4B Protein (NBP1-89594PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAGED4B Antibody

  • KIAA1859FLJ39060
  • MAGE1
  • MAGE-D4 antigen
  • MAGE-E1 antigen
  • MAGE-E1
  • MAGEE1MAGED4A
  • melanoma antigen family D, 4
  • MGC3210

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-872
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-46836
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31176
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32435
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-00129
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-13538
Species: Hu
Applications: ICC/IF, IHC, IHC-P
35680002
Species: Hu
Applications: WB, ELISA

Publications for MAGED4B Antibody (NBP1-89594) (0)

There are no publications for MAGED4B Antibody (NBP1-89594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGED4B Antibody (NBP1-89594) (0)

There are no reviews for MAGED4B Antibody (NBP1-89594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGED4B Antibody (NBP1-89594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAGED4B Products

Bioinformatics Tool for MAGED4B Antibody (NBP1-89594)

Discover related pathways, diseases and genes to MAGED4B Antibody (NBP1-89594). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGED4B Antibody (NBP1-89594)

Discover more about diseases related to MAGED4B Antibody (NBP1-89594).
 

Pathways for MAGED4B Antibody (NBP1-89594)

View related products by pathway.

Blogs on MAGED4B

There are no specific blogs for MAGED4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGED4B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGED4B
Uniprot