FAM156A Antibody

Western Blot: FAM156A Antibody [NBP2-46836] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251 MG, Lane 4: Human plasma, Lane 5: Human Analysis of human liver tissue., Lane 6: Human Tonsil tissue

Immunohistochemistry: FAM156A Antibody [NBP2-46836] - Staining of human uterus, pre-menopause shows strong cytoplasmic positivity with a granular pattern in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

FAM156A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPGPSQAVPLPEGLLRQRYREEKTLEE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM156A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FAM156A Recombinant Protein Antigen (NBP2-46836PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAM156A Antibody

• family with sequence similarity 156, member A
• TMEM29

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FAM156A
• Entrez:
  • 727866(Human)
• Uniprot:
  • Q8NDB6(Human)