LSM5 Antibody

Images

 
Western Blot: LSM5 Antibody [NBP2-85236] - WB Suggested Anti-LSM5 Antibody. Titration: 1.0 ug/ml. Positive Control: MCF7 Whole CellLSM5 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Ye, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LSM5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human LSM5. Peptide sequence: GFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (93%), Equine (100%), Yeast (100%), Zebrafish (93%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
LSM5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LSM5 Antibody

  • FLJ12710
  • LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae)
  • U6 snRNA-associated Sm-like protein LSm5
  • YER146W

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57504
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92083
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92084
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14206
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-04445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-48002
Species: Hu, Ca, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92085
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00527
Species: Hu, Mu, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-85236
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Ye, Ze
Applications: WB

Publications for LSM5 Antibody (NBP2-85236) (0)

There are no publications for LSM5 Antibody (NBP2-85236).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LSM5 Antibody (NBP2-85236) (0)

There are no reviews for LSM5 Antibody (NBP2-85236). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LSM5 Antibody (NBP2-85236) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LSM5 Products

Bioinformatics Tool for LSM5 Antibody (NBP2-85236)

Discover related pathways, diseases and genes to LSM5 Antibody (NBP2-85236). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for LSM5 Antibody (NBP2-85236)

View related products by pathway.

Research Areas for LSM5 Antibody (NBP2-85236)

Find related products by research area.

Blogs on LSM5

There are no specific blogs for LSM5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LSM5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LSM5