LRRC47 Antibody

Images

 
Western Blot: LRRC47 Antibody [NBP2-85230] - Host: Rabbit. Target Name: LRRC47. Sample Tissue: Mouse Spleen lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRC47 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse LRRC47. Peptide sequence: KELVRQLQLEAEEQRKQKKRQSVSGLHRYLHLLDGKENYPCLVDAEGDVI The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
LRRC47
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRC47 Antibody

  • KIAA1185
  • leucine rich repeat containing 47
  • leucine-rich repeat-containing protein 47

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00010598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-24859
Species: Hu, Mu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-73857
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
AF6457
Species: Hu
Applications: WB
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92327
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20265
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89725
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-73859
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
H00057180-B01P
Species: Hu
Applications: WB
NBP1-87679
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for LRRC47 Antibody (NBP2-85230) (0)

There are no publications for LRRC47 Antibody (NBP2-85230).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC47 Antibody (NBP2-85230) (0)

There are no reviews for LRRC47 Antibody (NBP2-85230). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRRC47 Antibody (NBP2-85230) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LRRC47 Products

Bioinformatics Tool for LRRC47 Antibody (NBP2-85230)

Discover related pathways, diseases and genes to LRRC47 Antibody (NBP2-85230). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for LRRC47 Antibody (NBP2-85230)

View related products by pathway.

PTMs for LRRC47 Antibody (NBP2-85230)

Learn more about PTMs related to LRRC47 Antibody (NBP2-85230).

Blogs on LRRC47

There are no specific blogs for LRRC47, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC47 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC47