LRIT3 Antibody (3E7) - Azide and BSA Free

Western Blot: LRIT3 Antibody (3E7) [H00345193-M09] - Analysis of LRIT3 expression in transfected 293T cell line by LRIT3 monoclonal antibody (M09), clone 3E7. Lane 1: LRIT3 transfected lysatE (60.521 KDa). Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: LRIT3 Antibody (3E7) [H00345193-M09] - Analysis of monoclonal antibody to LRIT3 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1.2 ug/ml

ELISA: LRIT3 Antibody (3E7) [H00345193-M09] - Detection limit for recombinant GST tagged FLJ44691 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 3E7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LRIT3 Antibody (3E7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse LRIT3 Antibody (3E7) - Azide and BSA Free (H00345193-M09) is a monoclonal antibody validated for use in IHC, WB and ELISA. Anti-LRIT3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: LRIT3 (NP_940908, 422 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWTRSHRDDSEKLLLCSRSSVESQVTFKSEGSRPEYYC
• Specificity: FLJ44691 (3E7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: LRIT3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA and immunohistochemistry (paraffin).

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LRIT3 Antibody (3E7) - Azide and BSA Free

• CSNB1F
• fibronectin type III, immunoglobulin and leucine rich repeat domains 4
• FIGLER4
• FLJ44691
• Gm421
• leucine-rich repeat, immunoglobulin-like and transmembrane domains 3
• leucine-rich repeat, immunoglobulin-like domain and transmembranedomain-containing protein 3
• LRIT3
• MGC120618

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LRIT3 Antibody (H00345193-M09)(1)

Publication using H00345193-M09

• Sun-Don Kim, Jia Lie Liu, Tony Roscioli, Michael F Buckley, Garima Yagnik, Simeon A Boyadjiev, Jinoh Kim. Leucine-rich repeat, immunoglobulin-like and transmembrane domain 3 (LRIT3) is a modulator of FGFR1, . FEBS Letters, 10.1016/j.febslet.2012.04.010. 2012-01-01 [PMID: 22673519] (WB, Human)

Bioinformatics

• Gene Symbol: LRIT3
• Entrez:
  • 345193(Human)
• Uniprot:
  • NP_940908()