![Western Blot: LRIT3 Antibody (3E7) [H00345193-M09] - Analysis of LRIT3 expression in transfected 293T cell line by LRIT3 monoclonal antibody (M09), clone 3E7. Lane 1: LRIT3 transfected lysatE (60.521 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/LRIT3-Antibody-3E7-Western-Blot-H00345193-M09-img0005.jpg "Western Blot: LRIT3 Antibody (3E7) [H00345193-M09] - Analysis of LRIT3 expression in transfected 293T cell line by LRIT3 monoclonal antibody (M09), clone 3E7. Lane 1: LRIT3 transfected lysatE (60.521 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 3E7 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | LRIT3 (NP_940908, 422 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWTRSHRDDSEKLLLCSRSSVESQVTFKSEGSRPEYYC |
| Specificity | FLJ44691 (3E7) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | LRIT3 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA and immunohistochemistry (paraffin). |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: LRIT3 Antibody (3E7) [H00345193-M09] - Analysis of monoclonal antibody to LRIT3 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1.2 ug/ml](http://images.novusbio.com/fullsize/LRIT3-Antibody-3E7-Immunohistochemistry-Paraffin-H00345193-M09-img0004.jpg "Immunohistochemistry-Paraffin: LRIT3 Antibody (3E7) [H00345193-M09] - Analysis of monoclonal antibody to LRIT3 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1.2 ug/ml")
![ELISA: LRIT3 Antibody (3E7) [H00345193-M09] - Detection limit for recombinant GST tagged FLJ44691 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/LRIT3-Antibody-3E7-ELISA-H00345193-M09-img0003.jpg "ELISA: LRIT3 Antibody (3E7) [H00345193-M09] - Detection limit for recombinant GST tagged FLJ44691 is approximately 0.1ng/ml as a capture antibody.")
![Immunohistochemistry-Paraffin: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] [NB7539] - FFPE serial sections of human stomach carcinoma. Primary Antibody: Mouse anti-p53 (Clone DO-1) used at a dilution of 1:100. Secondary Antibody: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] Conjugated used at a dilution of 1:200 (5ug/ml). Detection: DAB](https://images.novusbio.com/images/Goat-anti-Mouse-IgG-H+L-Secondary-Antibody-HRP-Immunohistochemistry-Paraffin-NB7539-img0014.jpg "Immunohistochemistry-Paraffin: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] [NB7539] - FFPE serial sections of human stomach carcinoma. Primary Antibody: Mouse anti-p53 (Clone DO-1) used at a dilution of 1:100. Secondary Antibody: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] Conjugated used at a dilution of 1:200 (5ug/ml). Detection: DAB")
