Liprin alpha 1 Recombinant Protein Antigen

Images

 
There are currently no images for Liprin alpha 1 Recombinant Protein Antigen (NBP2-58915PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Liprin alpha 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to Liprin alpha 1.

Source: E. coli

Amino Acid Sequence: HHKALDEKVRERLRVALERCSLLEEELGATHKELMILKEQNNQKKTLTDGVLDINHEQENTPSTSGKRSSDGSLSHEEDLAKVIELQEIISKQSREQSQMKERLASLSSHVTELEEDLDTAR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPFIA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58915.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Liprin alpha 1 Recombinant Protein Antigen

  • FLJ42630
  • FLJ43474
  • LAR-interacting protein 1
  • LIP.1
  • LIP-1
  • LIP1FLJ41337
  • LIPRIN
  • Liprin-alpha1
  • liprin-alpha-1
  • MGC26800
  • Protein tyrosine phosphatase receptor type f polypeptide-interacting proteinalpha-1
  • protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interactingprotein (liprin), alpha 1
  • PTPRF-interacting protein alpha-1

Background

Liprin alpha 1 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. This protein binds to the intracellular membrane-distal phosphatase domain of tyrosine phosphatase LAR, and appears to localize LAR to cell focal adhesions. This interaction may regulate the disassembly of focal adhesion and thus help orchestrate cell-matrix interactions. May regulate the disassembly of focal adhesions. May localize receptor-like tyrosine phosphatases type 2A at specific sites on the plasma membrane. possibly regulating their interaction with the extracellular environment and their association with substrates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42172
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00000302-M02
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
NBP2-13611
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-41211
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP3-14454
Species: Hu
Applications: IHC,  IHC-P
NBP1-91270
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB (-)
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-14835
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00023049-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP2-15018
Species: Mu, Rt
Applications: ICC/IF, WB
NBP2-15971
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
664-LI
Species: Hu
Applications: BA
NBP2-76718
Species: Hu
Applications: ELISA
NBP2-31560
Species: Hu
Applications: IHC,  IHC-P
NBP3-15951
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-58915PEP
Species: Hu
Applications: AC

Publications for Liprin alpha 1 Recombinant Protein Antigen (NBP2-58915PEP) (0)

There are no publications for Liprin alpha 1 Recombinant Protein Antigen (NBP2-58915PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Liprin alpha 1 Recombinant Protein Antigen (NBP2-58915PEP) (0)

There are no reviews for Liprin alpha 1 Recombinant Protein Antigen (NBP2-58915PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Liprin alpha 1 Recombinant Protein Antigen (NBP2-58915PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Liprin alpha 1 Products

Research Areas for Liprin alpha 1 Recombinant Protein Antigen (NBP2-58915PEP)

Find related products by research area.

Blogs on Liprin alpha 1

There are no specific blogs for Liprin alpha 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought


Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Liprin alpha 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPFIA1