Liprin alpha 1 Recombinant Protein Antigen

Images

 
There are currently no images for Liprin alpha 1 Protein (NBP2-38494PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Liprin alpha 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPFIA1.

Source: E.coli

Amino Acid Sequence: QLEETQHDKDQLVLNIEALRAELDHMRLRGASLHHGRPHLGSVPDFRFPMADGHTDSYSTSAVLRRPQKGRLAALRDEPSKVQTLNEQDWERAQQASVLANVAQAFESDADVSDGEDDRDTLLSSVDLLS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPFIA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38494.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Liprin alpha 1 Recombinant Protein Antigen

  • FLJ42630
  • FLJ43474
  • LAR-interacting protein 1
  • LIP.1
  • LIP-1
  • LIP1FLJ41337
  • LIPRIN
  • Liprin-alpha1
  • liprin-alpha-1
  • MGC26800
  • Protein tyrosine phosphatase receptor type f polypeptide-interacting proteinalpha-1
  • protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interactingprotein (liprin), alpha 1
  • PTPRF-interacting protein alpha-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42172
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF3928
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP2-13611
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Pm, Pm, Rb
Applications: IHC, IHC-P
NBP1-91271
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1756
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00023049-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-15018
Species: Mu, Rt
Applications: WB, ICC/IF
NBP2-67632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-31560
Species: Hu
Applications: IHC, IHC-P
MAB7047
Species: Hu
Applications: WB, ICC
NBP2-38494PEP
Species: Hu
Applications: AC

Publications for Liprin alpha 1 Protein (NBP2-38494PEP) (0)

There are no publications for Liprin alpha 1 Protein (NBP2-38494PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Liprin alpha 1 Protein (NBP2-38494PEP) (0)

There are no reviews for Liprin alpha 1 Protein (NBP2-38494PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Liprin alpha 1 Protein (NBP2-38494PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Liprin alpha 1 Products

Bioinformatics Tool for Liprin alpha 1 Protein (NBP2-38494PEP)

Discover related pathways, diseases and genes to Liprin alpha 1 Protein (NBP2-38494PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Liprin alpha 1 Protein (NBP2-38494PEP)

Discover more about diseases related to Liprin alpha 1 Protein (NBP2-38494PEP).
 

Pathways for Liprin alpha 1 Protein (NBP2-38494PEP)

View related products by pathway.

PTMs for Liprin alpha 1 Protein (NBP2-38494PEP)

Learn more about PTMs related to Liprin alpha 1 Protein (NBP2-38494PEP).

Blogs on Liprin alpha 1

There are no specific blogs for Liprin alpha 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought


Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Liprin alpha 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPFIA1