We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

LARS2 Recombinant Protein Antigen

Images

 
There are currently no images for LARS2 Recombinant Protein Antigen (NBP2-48830PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LARS2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LARS2.

Source: E. coli

Amino Acid Sequence: VIKWERRVIPGCTRSIYSATGKWTKEYTLQTRKDVEKWWHQRIKEQASKISEADKSKPKFYVLSMFPYPSGKLHMGHVRVYTISD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LARS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48830.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LARS2 Recombinant Protein Antigen

  • EC 6.1.1
  • EC 6.1.1.4
  • KIAA0028leucine tRNA ligase 2, mitocondrial
  • leucine translase
  • Leucine--tRNA ligase
  • leucyl-tRNA synthetase 2, mitochondrial
  • LEURS
  • MGC26121
  • probable leucyl-tRNA synthetase, mitochondrial

Background

LARS2, also known as Probable leucine--tRNA ligase, mitochondrial, is a 903 amino acid protein that is 102 kDa, catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. Disease research is currently being performed with relation to LARS2 and rocky mountain spotted fever, specific phobia, spotted fever, phobia, lactic acidosis, mitochondrial encephalomyopathy, encephalomyopathy, neisseria meningitides, bipolar disorder, nasopharyngitis, pneumonia, schizophrenia, tuberculosis, malaria, and carcinoma. This protein has been shown to have interactions with 20 proteins including ICT1, SRPR, PMM2, NMNAT1, and NAF1 in tRNA aminoacylation, gene expression, mitochondrial tRNA aminoacylation, valine, leucine and isoleucine biosynthesis, and aminoacyl-tRNA biosynthesis pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-526
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
AF3844
Species: Hu, Mu
Applications: IHC
NBP3-03965
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP3-38079
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-59320
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-81746
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84637
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-45604
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
NBP1-48002
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-85740
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-19702
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for LARS2 Recombinant Protein Antigen (NBP2-48830PEP) (0)

There are no publications for LARS2 Recombinant Protein Antigen (NBP2-48830PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LARS2 Recombinant Protein Antigen (NBP2-48830PEP) (0)

There are no reviews for LARS2 Recombinant Protein Antigen (NBP2-48830PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LARS2 Recombinant Protein Antigen (NBP2-48830PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LARS2 Products

Blogs on LARS2

There are no specific blogs for LARS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LARS2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LARS2