LARS2 Antibody

Immunocytochemistry/Immunofluorescence: LARS2 Antibody [NBP2-57749] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Product Discontinued

LARS2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GCSWRSGAKVEQKYLRQWFIKTTAYAKAMQDALADLPEWYGIKGMQAHWIGDCVGCHLDFTLKVHGQATGEKLTAYTATPE
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LARS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LARS2 Antibody

• EC 6.1.1
• EC 6.1.1.4
• KIAA0028leucine tRNA ligase 2, mitocondrial
• leucine translase
• Leucine--tRNA ligase
• leucyl-tRNA synthetase 2, mitochondrial
• LEURS
• MGC26121
• probable leucyl-tRNA synthetase, mitochondrial

Background

LARS2, also known as Probable leucine--tRNA ligase, mitochondrial, is a 903 amino acid protein that is 102 kDa, catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. Disease research is currently being performed with relation to LARS2 and rocky mountain spotted fever, specific phobia, spotted fever, phobia, lactic acidosis, mitochondrial encephalomyopathy, encephalomyopathy, neisseria meningitides, bipolar disorder, nasopharyngitis, pneumonia, schizophrenia, tuberculosis, malaria, and carcinoma. This protein has been shown to have interactions with 20 proteins including ICT1, SRPR, PMM2, NMNAT1, and NAF1 in tRNA aminoacylation, gene expression, mitochondrial tRNA aminoacylation, valine, leucine and isoleucine biosynthesis, and aminoacyl-tRNA biosynthesis pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LARS2 Antibody (NBP2-57749)(1)

Publication using NBP2-57749

• Wang Z, Lu Z, Lin S et al. Leucine-tRNA-synthase-2-expressing B cells contribute to colorectal cancer immunoevasion Immunity 2022-06-14 [PMID: 35659337]

Bioinformatics

• Gene Symbol: LARS2