L1TD1 Antibody

Images

 
Immunohistochemistry: L1TD1 Antibody [NBP1-90481] - Staining of human nasopharynx shows strong cytoplasmic, membranous and nuclear positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

L1TD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IDSVEDSESEEEEEGKSSETGKVKTTSLTEKKASRRQKEIPFSYLVGDSGKKKLVKHQVVHKTQEEEETAVPTSQGTGTPC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
L1TD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
L1TD1 Protein (NBP1-90481PEP)
Publications
Read Publication using NBP1-90481.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25702638)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for L1TD1 Antibody

  • ECAT11
  • ES cell-associated protein 11
  • FLJ10884
  • L1TD1
  • LINE-1 type transposase domain containing 1
  • LINE-1 type transposase domain-containing protein 1
  • MGC133253
  • RP5-1155K23.3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3757
Species: Hu
Applications: WB, ICC
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NB110-40579
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-90481
Species: Hu
Applications: IHC, IHC-P

Publications for L1TD1 Antibody (NBP1-90481)(1)

We have publications tested in 1 application: IP.


Filter By Application
IP
(1)
All Applications
Filter By Species
All Species

Reviews for L1TD1 Antibody (NBP1-90481) (0)

There are no reviews for L1TD1 Antibody (NBP1-90481). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for L1TD1 Antibody (NBP1-90481) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional L1TD1 Products

L1TD1 NBP1-90481

Bioinformatics Tool for L1TD1 Antibody (NBP1-90481)

Discover related pathways, diseases and genes to L1TD1 Antibody (NBP1-90481). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for L1TD1 Antibody (NBP1-90481)

Discover more about diseases related to L1TD1 Antibody (NBP1-90481).
 

Pathways for L1TD1 Antibody (NBP1-90481)

View related products by pathway.

Blogs on L1TD1

There are no specific blogs for L1TD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our L1TD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol L1TD1
Entrez