Kv9.2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Kv9.2 Antibody [NBP2-14145] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kv9.2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNS2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Kv9.2 Protein (NBP2-14145PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Kv9.2 Antibody - BSA Free

• Delayed-rectifier K(+) channel alpha subunit 2
• KIAA1144
• KV9.2
• potassium voltage-gated channel subfamily S member 2
• potassium voltage-gated channel, delayed-rectifier, subfamily S, member 2
• Voltage-gated potassium channel subunit Kv9.2

Background

Voltage-gated K+ channels in the plasma membrane control the repolarization and the frequency of action potentials in neurons, muscles and other excitable cells. The KV gene family encodes more than 30 proteins that comprise the subunits of the K+ channels, and they vary in their gating and permeation properties, subcellular distribution and expression patterns. Functional KV channels assemble as tetramers consisting of pore-forming alpha subunits (KV), which include the KV1, KV2, KV3, KV4 and KV9 proteins, and accessory or KV-subunits that modify the gating properties of the coexpressed KV subunits. KV9.2 is a K+ channel subunit that reduces the ion flow and regulates channel activity. It localizes to the cell membrane and, in the absence of KCNB1, KV9.2 may not reach the plasma membrane and may remain in an intracellular compartment.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNS2