Kv5.1 Recombinant Protein Antigen

Images

 
There are currently no images for Kv5.1 Protein (NBP1-81605PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kv5.1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNF1.

Source: E.coli

Amino Acid Sequence: VRYYNKQRVLETAAKHELELMELNSSSGGEGKTGGSRSDLDNLPPEPAGKEAPSCSSRLKLSHSDTFIPLLTEEKHHRTRLQSCK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81605.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Kv5.1 Recombinant Protein Antigen

  • IK8
  • kH1
  • KV5.1
  • MGC33316
  • potassium channel KH1
  • potassium channel Kv5.1
  • potassium voltage-gated channel subfamily F member 1
  • potassium voltage-gated channel, subfamily F, member 1
  • voltage-gated potassium channel subunit Kv5.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81572
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
H00170850-Q01
Species: Hu
NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP2-80513
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84935
Species: Hu
Applications: IHC, IHC-P
NBP2-76939
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
NBP1-89717
Species: Hu
Applications: IHC, IHC-P
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
NBP2-17028
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-67689
Species: Hu, Mu, Fi, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12897
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-80064
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Pm, Rb, Ze
Applications: WB
NBP1-74103
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP2-67704
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00003738-M01
Species: Hu
Applications: WB, ELISA
NBP2-75552
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-14141
Species: Hu
Applications: IHC, IHC-P
NBP1-81605PEP
Species: Hu
Applications: AC

Publications for Kv5.1 Protein (NBP1-81605PEP) (0)

There are no publications for Kv5.1 Protein (NBP1-81605PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv5.1 Protein (NBP1-81605PEP) (0)

There are no reviews for Kv5.1 Protein (NBP1-81605PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kv5.1 Protein (NBP1-81605PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Kv5.1 Products

Bioinformatics Tool for Kv5.1 Protein (NBP1-81605PEP)

Discover related pathways, diseases and genes to Kv5.1 Protein (NBP1-81605PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv5.1 Protein (NBP1-81605PEP)

Discover more about diseases related to Kv5.1 Protein (NBP1-81605PEP).

PTMs for Kv5.1 Protein (NBP1-81605PEP)

Learn more about PTMs related to Kv5.1 Protein (NBP1-81605PEP).

Blogs on Kv5.1

There are no specific blogs for Kv5.1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kv5.1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNF1