KNL-2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KNL-2 Antibody [29530002] - This image is specific to animal number SDQ0810
Immunocytochemistry/ Immunofluorescence: KNL-2 Antibody [29530002] - This image is specific to animal number SDQ0803

Product Details

Summary
Reactivity CeSpecies Glossary
Applications ELISA, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KNL-2 Antibody Summary

Immunogen
This antibody was made against a protein fragment from the N Terminus Region
Epitope
YTLRAPKSQNGEPITPIRFTRGHDNGGAKKVFIFEQTPVRKQGPIASSTPQQKQRLADGANNQIPPTQKSQDSVQAVQPPPPRPAARNAQFASDADLFAV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MIS18BP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
Application Notes
This antibody works in ELISA, Immunofluorescence. The concentration for this product is lot dependent. Check product vial for current lot concentration. Typically concentration ranges from 0.5 to 1.5 mg/ml.
Publications
Read Publications using 29530002.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for KNL-2 Antibody

  • C14orf106
  • chromosome 14 open reading frame 106
  • FLJ11186
  • hsKNL-2
  • KIAA1903HSA242977
  • Kinetochore-associated protein KNL-2 homolog
  • KNL2
  • M18BP1
  • MIS18 binding protein 1
  • mis18-binding protein 1
  • P243
  • putative protein p243 which interacts with transcription factor Sp1

Background

C14orf106 is required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NBP2-13688
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55474
Species: Hu
Applications: ICC/IF
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB120-3535
Species: Hu, Mu, Fi
Applications: WB, ICC/IF, IHC
NBP1-88943
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85025
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
29530002
Species: Ce
Applications: ELISA, ICC/IF
Supplier Logo

Publications for KNL-2 Antibody (29530002)(2)

Reviews for KNL-2 Antibody (29530002) (0)

There are no reviews for KNL-2 Antibody (29530002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KNL-2 Antibody (29530002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KNL-2 Products

Bioinformatics Tool for KNL-2 Antibody (29530002)

Discover related pathways, diseases and genes to KNL-2 Antibody (29530002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for KNL-2 Antibody (29530002)

View related products by pathway.

PTMs for KNL-2 Antibody (29530002)

Learn more about PTMs related to KNL-2 Antibody (29530002).

Blogs on KNL-2

There are no specific blogs for KNL-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KNL-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MIS18BP1
Uniprot