KNL-2 Antibody

Product Discontinued

KNL-2 Antibody Summary

• Immunogen: This antibody was made against a protein fragment from the N Terminus Region
• Epitope: YTLRAPKSQNGEPITPIRFTRGHDNGGAKKVFIFEQTPVRKQGPIASSTPQQKQRLADGANNQIPPTQKSQDSVQAVQPPPPRPAARNAQFASDADLFAV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MIS18BP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
• Application Notes: This antibody works in ELISA, Immunofluorescence. The concentration for this product is lot dependent. Check product vial for current lot concentration. Typically concentration ranges from 0.5 to 1.5 mg/ml.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for KNL-2 Antibody

• C14orf106
• chromosome 14 open reading frame 106
• FLJ11186
• hsKNL-2
• KIAA1903HSA242977
• Kinetochore-associated protein KNL-2 homolog
• KNL2
• M18BP1
• MIS18 binding protein 1
• mis18-binding protein 1
• P243
• putative protein p243 which interacts with transcription factor Sp1

Background

C14orf106 is required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KNL-2 Antibody (29530002)(2)

Publications using 29530002

• Garrison C, Lastwika K, Zhang Y et al. Proteomic Analysis, Immune Dysregulation, and Pathway Interconnections With Obesity J Proteome Res. 2017-01-06 [PMID: 27769113] (MiAr)
  
  Details:
  Analysis is performed on plasma proteomic data to identify how obesity can alter pathways and to highlight the risk factor for disease in subjects with a high body mass index.
• Rho JH, Lampe PD. High-throughput screening for native autoantigen-autoantibody complexes using antibody microarrays J Proteome Res. 2013-05-03 [PMID: 23541305] (MiAr)
  
  Details:
  A novel method using antibody microarrays is used to detect autoantibody-antigen complexes that can potentially be useful for detection and characterization of diseases.

Bioinformatics

• Gene Symbol: MIS18BP1
• Uniprot:
  • K06A5.4(Human)