KLHL5 Antibody

Images

 
Western Blot: KLHL5 Antibody [NBP2-83121] - WB Suggested Anti-KLHL5 Antibody Titration: 5.0ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLHL5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human KLHL5. Peptide sequence: NRGQTGANGGRKFLDPCSLQLPLASIGYRRSSQLDFQNSPSWPMASTSEV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
KLHL5
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for KLHL5 Antibody

  • DKFZp586M1418
  • FLJ11313
  • kelch-like 5 (Drosophila)
  • lymphocyte activation-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81162
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF1914
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
NBP1-84682
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-77146
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-02939
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, WB
AF566
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP1-33773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-83121
Species: Hu
Applications: WB

Publications for KLHL5 Antibody (NBP2-83121) (0)

There are no publications for KLHL5 Antibody (NBP2-83121).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHL5 Antibody (NBP2-83121) (0)

There are no reviews for KLHL5 Antibody (NBP2-83121). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLHL5 Antibody (NBP2-83121) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLHL5 Products

Array NBP2-83121

Bioinformatics Tool for KLHL5 Antibody (NBP2-83121)

Discover related pathways, diseases and genes to KLHL5 Antibody (NBP2-83121). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for KLHL5 Antibody (NBP2-83121)

View related products by pathway.

Blogs on KLHL5

There are no specific blogs for KLHL5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLHL5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHL5