KLHL5 Antibody


Western Blot: KLHL5 Antibody [NBP2-83121] - WB Suggested Anti-KLHL5 Antibody Titration: 5.0ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate

Product Details

Reactivity HuSpecies Glossary
Applications WB
1 mg/ml

Order Details

KLHL5 Antibody Summary

The immunogen is a synthetic peptide directed towards the N-terminal region of human KLHL5. Peptide sequence: NRGQTGANGGRKFLDPCSLQLPLASIGYRRSSQLDFQNSPSWPMASTSEV The peptide sequence for this immunogen was taken from within the described region.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
1 mg/ml
Protein A purified

Alternate Names for KLHL5 Antibody

  • DKFZp586M1418
  • FLJ11313
  • kelch-like 5 (Drosophila)
  • lymphocyte activation-associated protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, WB
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB

Publications for KLHL5 Antibody (NBP2-83121) (0)

There are no publications for KLHL5 Antibody (NBP2-83121).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHL5 Antibody (NBP2-83121) (0)

There are no reviews for KLHL5 Antibody (NBP2-83121). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLHL5 Antibody (NBP2-83121) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KLHL5 Products

Array NBP2-83121

Pathways for KLHL5 Antibody (NBP2-83121)

View related products by pathway.

Blogs on KLHL5

There are no specific blogs for KLHL5, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KLHL5 Antibody and receive a gift card or discount.


Gene Symbol KLHL5