Recombinant Human KLHL17 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human KLHL17 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 187 of Human KLHL17 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSESRQTHVTLHDIDPQALDQLVQFAYTAEIVVGEGNVQTLLPAASLLQLNGVRDACCKFLLSQLDPSNCLGIRGFADAHSCSDLLKAAHRYVLQHFVDVAKTEEFMLLPLKQVTAGGPSPRPPPHPTPVFVFDSRPRFVPDTALPTILSACCVSPRPSWIWAPQEPRLWLLTLLGPSQYEHSAPTC

Protein/Peptide Type
Recombinant Protein
Gene
KLHL17

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KLHL17 Protein

  • actinfilin
  • kelch-like 17 (Drosophila)
  • kelch-like protein 17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-58788
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-02939
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF
NB400-149
Species: Hu, Mu, Bv, Rt(-)
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KLHL17 Recombinant Protein (H00339451-P01) (0)

There are no publications for KLHL17 Recombinant Protein (H00339451-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHL17 Recombinant Protein (H00339451-P01) (0)

There are no reviews for KLHL17 Recombinant Protein (H00339451-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLHL17 Recombinant Protein (H00339451-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KLHL17 Products

Bioinformatics Tool for KLHL17 Recombinant Protein (H00339451-P01)

Discover related pathways, diseases and genes to KLHL17 Recombinant Protein (H00339451-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHL17 Recombinant Protein (H00339451-P01)

Discover more about diseases related to KLHL17 Recombinant Protein (H00339451-P01).
 

Pathways for KLHL17 Recombinant Protein (H00339451-P01)

View related products by pathway.

PTMs for KLHL17 Recombinant Protein (H00339451-P01)

Learn more about PTMs related to KLHL17 Recombinant Protein (H00339451-P01).

Blogs on KLHL17

There are no specific blogs for KLHL17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PDZK1 Antibody
NB400-149
KLHL17 Antibody
NBP1-85926

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KLHL17 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHL17