KIAA1671 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KIAA1671 Antibody [NBP1-91085] - Staining of human cell line A-431 shows localization to microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: KIAA1671 Antibody [NBP1-91085] - Staining of human Placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: KIAA1671 Antibody [NBP1-91085] - Staining of human breast shows cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: KIAA1671 Antibody [NBP1-91085] - Staining of human Fallopian tube shows moderate membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: KIAA1671 Antibody [NBP1-91085] - Staining of human Tonsil shows strong membranous and cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIAA1671 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PISHSLRRSRFSESESRSPLEDETDNTWMFKDSTEEKSPRKEESDEEETASKAERTPVSHPQRMPAFPGMDPAVLKAQLHKRPEVDSPGETPSWAPQPKSPKSPFQPGVLGSRVLPSSMDKDERSDEPSPQWLKELKSKKRQSL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA1671
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KIAA1671 Protein (NBP1-91085PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIAA1671 Antibody

  • KIAA1671

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-15939
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF771
Species: Mu
Applications: IHC, Neut, WB
NBP1-06519
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-81404
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB

Publications for KIAA1671 Antibody (NBP1-91085) (0)

There are no publications for KIAA1671 Antibody (NBP1-91085).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA1671 Antibody (NBP1-91085) (0)

There are no reviews for KIAA1671 Antibody (NBP1-91085). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KIAA1671 Antibody (NBP1-91085) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIAA1671 Products

Bioinformatics Tool for KIAA1671 Antibody (NBP1-91085)

Discover related pathways, diseases and genes to KIAA1671 Antibody (NBP1-91085). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA1671 Antibody (NBP1-91085)

Discover more about diseases related to KIAA1671 Antibody (NBP1-91085).

Blogs on KIAA1671

There are no specific blogs for KIAA1671, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIAA1671 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA1671