KIAA1468 Recombinant Protein Antigen

Images

 
There are currently no images for KIAA1468 Protein (NBP1-93851PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KIAA1468 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIAA1468.

Source: E.coli

Amino Acid Sequence: EAYSALSCCFISEDLMVNHFLPGLRCLRTDMEHLSPEHEVILSSMIKECEQKVENKTVQEPQGSMSIAASLVSEDTKTKF

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIAA1468
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-93851.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for KIAA1468 Recombinant Protein Antigen

  • HsT3308
  • KIAA1468

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56508
Species: Hu, Mu, Rt, Av
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP1-81248
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-76981
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP, ICC, IF
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82904
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-41309
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-98518
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85978
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88882
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-93198
Species: Hu, Mu, Rt
Applications: WB
NBP2-61107
Species: Hu
Applications: WB, IP
NBP1-82192
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89319
Species: Hu
Applications: IHC, IHC-P
NB100-60439
Species: Hu, Mu
Applications: WB, IP
NBP3-05007
Species: Hu, Mu, Rt
Applications: WB
NBP1-93851PEP
Species: Hu
Applications: AC

Publications for KIAA1468 Protein (NBP1-93851PEP) (0)

There are no publications for KIAA1468 Protein (NBP1-93851PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA1468 Protein (NBP1-93851PEP) (0)

There are no reviews for KIAA1468 Protein (NBP1-93851PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KIAA1468 Protein (NBP1-93851PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional KIAA1468 Products

Bioinformatics Tool for KIAA1468 Protein (NBP1-93851PEP)

Discover related pathways, diseases and genes to KIAA1468 Protein (NBP1-93851PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA1468 Protein (NBP1-93851PEP)

Discover more about diseases related to KIAA1468 Protein (NBP1-93851PEP).

Blogs on KIAA1468

There are no specific blogs for KIAA1468, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KIAA1468 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA1468