KCNN4 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

KCNN4 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNN4
  
  

  Source: E.coli

  Amino Acid Sequence: LQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: KCNN4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24935It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KCNN4 Recombinant Protein Antigen

• hIKCa1
• hKCa4
• hSK4
• IK1
• IKCa1
• intermediate conductance calcium-activated potassium channel protein 4
• KCa3.1
• KCa3.1IKCA1
• KCa4
• KCA4SKCa4
• KCNN4
• potassium intermediate/small conductance calcium-activated channel, subfamilyN, member 4
• putative erythrocyte intermediate conductance calcium-activated potassiumGardos channel
• Putative Gardos channel
• SK4
• SK4SKCa 4
• SKCa 4
• SKCa4

Background

KCNN4 (Kca3.1) is part of a potentially heterotetrameric voltage independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane hyperpolarization, which promotes calcium influx. KCNN4 may be part of the predominant calcium activated potassium channel in T lymphocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNN4