KCNMB4 Recombinant Protein Antigen

Images

 
There are currently no images for KCNMB4 Recombinant Protein Antigen (NBP2-56583PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KCNMB4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNMB4.

Source: E. coli

Amino Acid Sequence: CWLSPALQDLQATEANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNMB4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56583.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KCNMB4 Recombinant Protein Antigen

  • BK channel subunit beta-4
  • BKbeta4
  • calcium-activated potassium channel subunit beta-4
  • Calcium-activated potassium channel, subfamily M subunit beta-4
  • Charybdotoxin receptor subunit beta-4
  • hbeta4
  • k(VCA)beta-4
  • large conductance calcium-dependent potassium ion channel beta 4 subunit
  • Maxi K channel subunit beta-4
  • potassium large conductance calcium-activated channel, subfamily M, beta member4
  • slo-beta-4

Background

KCNMB4, also known as Calcium-activated potassium channel subunit beta-4, is a 210 amino acid protein that is 34 kDa; predominantly expressed in brain; regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channels which are fundamental to the control of smooth muscle tone and neuronal excitability; is an auxiliary beta subunit which slows activation kinetics, leads to steeper calcium sensitivity, and shifts the voltage range of current activation to more negative potentials than does the beta 1 subunit. Current research is being pursued on this protein involvement in several diseases and disorders including neurological disorder, corpus callosum, epilepsy syndrome, seizures, neuronitis, and cerebritis. This protein has been linked to the hemostasis, potassium channels, Ca2+ activated K+ channels, cGMP effects, platelet homeostasis, synaptic transmission- ion currents, and vascular smooth muscle contraction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-48775
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB300-535
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-83065
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-05145
Species: Mu, Rt
Applications: WB
AF640
Species: Mu
Applications: IHC, WB
NBP1-86893
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-755
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
NBP2-01526
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-05611
Species: Rt
Applications: ELISA, WB
NBP3-05611
Species: Rt
Applications: ELISA, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-305
Species: Hu, Pm, Mu
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-33694
Species: Hu
Applications: IHC,  IHC-P

Publications for KCNMB4 Recombinant Protein Antigen (NBP2-56583PEP) (0)

There are no publications for KCNMB4 Recombinant Protein Antigen (NBP2-56583PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNMB4 Recombinant Protein Antigen (NBP2-56583PEP) (0)

There are no reviews for KCNMB4 Recombinant Protein Antigen (NBP2-56583PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KCNMB4 Recombinant Protein Antigen (NBP2-56583PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KCNMB4 Products

Blogs on KCNMB4

There are no specific blogs for KCNMB4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KCNMB4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNMB4