KCNMB4 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

KCNMB4 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNMB4.

  Source: E. coli

  Amino Acid Sequence: CWLSPALQDLQATEANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: KCNMB4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56583.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KCNMB4 Recombinant Protein Antigen

• BK channel subunit beta-4
• BKbeta4
• calcium-activated potassium channel subunit beta-4
• Calcium-activated potassium channel, subfamily M subunit beta-4
• Charybdotoxin receptor subunit beta-4
• hbeta4
• k(VCA)beta-4
• large conductance calcium-dependent potassium ion channel beta 4 subunit
• Maxi K channel subunit beta-4
• potassium large conductance calcium-activated channel, subfamily M, beta member4
• slo-beta-4

Background

KCNMB4, also known as Calcium-activated potassium channel subunit beta-4, is a 210 amino acid protein that is 34 kDa; predominantly expressed in brain; regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channels which are fundamental to the control of smooth muscle tone and neuronal excitability; is an auxiliary beta subunit which slows activation kinetics, leads to steeper calcium sensitivity, and shifts the voltage range of current activation to more negative potentials than does the beta 1 subunit. Current research is being pursued on this protein involvement in several diseases and disorders including neurological disorder, corpus callosum, epilepsy syndrome, seizures, neuronitis, and cerebritis. This protein has been linked to the hemostasis, potassium channels, Ca2+ activated K+ channels, cGMP effects, platelet homeostasis, synaptic transmission- ion currents, and vascular smooth muscle contraction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: KCNMB4