KCNA10 Antibody - BSA Free

Immunohistochemistry-Paraffin: KCNA10 Antibody [NBP3-10357] - Immunohistochemical analysis of formalin-fixed paraffin-embedded human heart tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

KCNA10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCNA10 Antibody - BSA Free (NBP3-10357) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCNA10 (NP_005540). Peptide sequence DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNA10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 58 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KCNA10 Antibody - BSA Free

• cyclic GMP gated potassium channel
• Kcn1
• KCNA10
• Kv1.8
• potassium voltage-gated channel subfamily A member 10
• potassium voltage-gated channel, shaker-related subfamily, member 10
• Voltage-gated potassium channel subunit Kv1.8

Background

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Four sequence-related potassium channel genes, shaker, shaw, shab, and shal, have been identified in Drosophila, and each has been shown to have human homolog(s). KCNA10 encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNA10