KAT1 Recombinant Protein Antigen

Images

 
There are currently no images for KAT1 Protein (NBP1-87835PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KAT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HAT1.

Source: E. coli

Amino Acid Sequence: KFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HAT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87835.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KAT1 Recombinant Protein Antigen

  • EC 2.3.1.48
  • histone acetyltransferase 1
  • histone acetyltransferase type B catalytic subunit
  • KAT1

Background

In the intact cell, DNA closely associates with histones and other nuclear proteins to form chromatin. The remodeling of chromatin is believed to be a critical component of transcriptional regulation and a major source of this remodeling is brought about by the acetylation of nucleosomal histones. Acetylation of lysine residues in the amino terminal tail domain of histone results in an allosteric change in the nucleosomal conformation and an increased accessibility to transcription factors by DNA. Conversely, the deacetylation of histones is associated with transcriptional silencing. Several mammalian proteins have been identified as nuclear histone acetylases, including GCN5, PCAF (p300/CBPassociated factor), p300/CBP, HAT1, and the TFIID subunit TAF II p250. Mammalian HDAC1 (also designated HD1), HDAC2 (also designated RPD3) and HDAC3-6, have been identified as histone deacetylases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-46113
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
NBL1-11570
Species: Hu
Applications: WB
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
Applications: WB
NBP1-89627
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
2695-SE
Species: Hu
Applications: EnzAct
NBP3-37988
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-46655
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-46656
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-80959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85482
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP1-87109
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF23151
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-87835PEP
Species: Hu
Applications: AC

Publications for KAT1 Protein (NBP1-87835PEP) (0)

There are no publications for KAT1 Protein (NBP1-87835PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KAT1 Protein (NBP1-87835PEP) (0)

There are no reviews for KAT1 Protein (NBP1-87835PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KAT1 Protein (NBP1-87835PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KAT1 Products

Research Areas for KAT1 Protein (NBP1-87835PEP)

Find related products by research area.

Blogs on KAT1

There are no specific blogs for KAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KAT1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HAT1