Recombinant Human INPP4B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human INPP4B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 19360 of Human INPP4B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
INPP4B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human INPP4B Protein

  • inositol polyphosphate-4-phosphatase, type II, 105kDa
  • type II inositol-3,4-bisphosphate 4-phosphatase

Background

INPP4B( AAH05273, 1 a.a. - 54 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
MAB2317
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
26160002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP2-49463
Species: Hu
Applications: IHC, IHC-P
NBP2-19621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-15832
Species: Hu
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-13510
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for INPP4B Recombinant Protein (H00008821-P01) (0)

There are no publications for INPP4B Recombinant Protein (H00008821-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INPP4B Recombinant Protein (H00008821-P01) (0)

There are no reviews for INPP4B Recombinant Protein (H00008821-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INPP4B Recombinant Protein (H00008821-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional INPP4B Products

Bioinformatics Tool for INPP4B Recombinant Protein (H00008821-P01)

Discover related pathways, diseases and genes to INPP4B Recombinant Protein (H00008821-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INPP4B Recombinant Protein (H00008821-P01)

Discover more about diseases related to INPP4B Recombinant Protein (H00008821-P01).
 

Pathways for INPP4B Recombinant Protein (H00008821-P01)

View related products by pathway.

PTMs for INPP4B Recombinant Protein (H00008821-P01)

Learn more about PTMs related to INPP4B Recombinant Protein (H00008821-P01).
 

Research Areas for INPP4B Recombinant Protein (H00008821-P01)

Find related products by research area.

Blogs on INPP4B

There are no specific blogs for INPP4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-15 [Unconjugated]
247-ILB-005/CF
INPP4B Antibody
NBP1-85883

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human INPP4B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol INPP4B