INO80C Antibody

Images

 
Western Blot: INO80C Antibody [NBP2-83078] - Host: Rabbit. Target Name: INO80C. Sample Type: PANC1 Whole cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

INO80C Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human INO80C. Peptide sequence: VATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISME The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (93%), Rabbit (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
INO80C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for INO80C Antibody

  • C18orf37
  • chromosome 18 open reading frame 37
  • FLJ38183
  • hIes6
  • IES6 homolog
  • IES6
  • INO80 complex subunit C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP2-20932
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-57495
Species: Hu
Applications: WB, IP
NBP2-93083
Species: Mu, Rt
Applications: WB
NBP1-78758
Species: Hu
Applications: WB (-), IP
AF3844
Species: Hu, Mu
Applications: IHC
H00146956-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-92770
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38025
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
NBP2-83078
Species: Hu, Mu, Rt, Rb
Applications: WB

Publications for INO80C Antibody (NBP2-83078) (0)

There are no publications for INO80C Antibody (NBP2-83078).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INO80C Antibody (NBP2-83078) (0)

There are no reviews for INO80C Antibody (NBP2-83078). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INO80C Antibody (NBP2-83078) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional INO80C Products

Bioinformatics Tool for INO80C Antibody (NBP2-83078)

Discover related pathways, diseases and genes to INO80C Antibody (NBP2-83078). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on INO80C

There are no specific blogs for INO80C, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INO80C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INO80C