IFLTD1 Antibody


Western Blot: IFLTD1 Antibody [NBP1-56726] - Human Intestine, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

IFLTD1 Antibody Summary

Synthetic peptides corresponding to IFLTD1(intermediate filament tail domain containing 1) The peptide sequence was selected from the middle region of IFLTD1. Peptide sequence PPTVFPNRSPWCQNPYVSAHPYCPLIEPHNTSTAGGRLDRQPRSRSTRPN.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against IFLTD1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IFLTD1 Antibody

  • FLJ36004
  • intermediate filament tail domain containing 1
  • intermediate filament tail domain-containing protein 1
  • Pas1c1


The specific function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for IFLTD1 Antibody (NBP1-56726) (0)

There are no publications for IFLTD1 Antibody (NBP1-56726).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFLTD1 Antibody (NBP1-56726) (0)

There are no reviews for IFLTD1 Antibody (NBP1-56726). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFLTD1 Antibody (NBP1-56726) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional IFLTD1 Products

Bioinformatics Tool for IFLTD1 Antibody (NBP1-56726)

Discover related pathways, diseases and genes to IFLTD1 Antibody (NBP1-56726). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFLTD1 Antibody (NBP1-56726)

Discover more about diseases related to IFLTD1 Antibody (NBP1-56726).

Blogs on IFLTD1

There are no specific blogs for IFLTD1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IFLTD1 Antibody and receive a gift card or discount.


Gene Symbol IFLTD1