IDH3G Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: IDH3G Antibody [NBP1-85810] - Staining of human cell line U-2 OS shows localization to nucleoli & mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: IDH3G Antibody [NBP1-85810] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: IDH3G Antibody [NBP1-85810] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: IDH3G Antibody [NBP1-85810] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: IDH3G Antibody [NBP1-85810] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla)

Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17Lane 2: Human cell line RT-4

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IDH3G Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IDH3G Antibody - BSA Free (NBP1-85810) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-IDH3G Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IDH3G
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IDH3G Protein (NBP1-85810PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IDH3G Antibody - BSA Free

• EC 1.1.1
• EC 1.1.1.41
• H-IDHG
• IDH-gamma
• isocitrate dehydrogenase 3 (NAD+) gamma
• isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, gamma subunit
• mitochondrial
• NAD (H)-specific isocitrate dehydrogenase gamma subunit
• NAD+-specific ICDH

Background

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the gamma subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. This gene is a candidate gene for periventricular heterotopia. Several alternatively spliced transcript variants of this gene have been described, but only some of their full length natures have been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IDH3G Antibody (NBP1-85810)(2)

Publications using NBP1-85810

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]
• Fischer AJ, Goss KL, Scheetz TE et al. Differential gene expression in human conducting airway surface epithelia and submucosal glands. Am J Respir Cell Mol Biol 2009-02-01 [PMID: 18703793]

Bioinformatics

• Gene Symbol: IDH3G