Recombinant Human Hsp70 interacting protein HIP Protein

Product Discontinued

Recombinant Human Hsp70 interacting protein HIP Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 21186 of Human ST13 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF

• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: ST13
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 32.12 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Hsp70 interacting protein HIP Protein

• AAG2
• aging-associated protein 2
• FAM10A1FAM10A4
• heat shock 70kD protein binding protein
• Hip
• HIPFLJ27260
• HOP
• hsc70-interacting protein
• Hsp70-interacting protein
• HSPABP1
• P48MGC129952
• PRO0786
• Progesterone receptor-associated p48 protein
• Protein FAM10A1
• Putative tumor suppressor ST13
• Renal carcinoma antigen NY-REN-33
• SNC6HSPABP
• suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
• suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein)
• Suppression of tumorigenicity 13 protein

Background

The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ST13