We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human Hsp70 interacting protein HIP Protein

Images

 

Order Details


    • Catalog Number
      H00006767-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Hsp70 interacting protein HIP Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 21186 of Human ST13 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ST13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
32.12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Hsp70 interacting protein HIP Protein

  • AAG2
  • aging-associated protein 2
  • FAM10A1FAM10A4
  • heat shock 70kD protein binding protein
  • Hip
  • HIPFLJ27260
  • HOP
  • hsc70-interacting protein
  • Hsp70-interacting protein
  • HSPABP1
  • P48MGC129952
  • PRO0786
  • Progesterone receptor-associated p48 protein
  • Protein FAM10A1
  • Putative tumor suppressor ST13
  • Renal carcinoma antigen NY-REN-33
  • SNC6HSPABP
  • suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
  • suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein)
  • Suppression of tumorigenicity 13 protein

Background

The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1972
Species: Ba, Ca, Ch, Fi, Gp, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-90268
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00010963-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NBP2-75440
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-16991
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB300-576
Species: Ch, Gp, Hu, Mu, Pm, Rb, Rt, Xp
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-03433
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF5110
Species: Mu
Applications: IHC, WB
H00007178-M06
Species: Hu, Mu, Rt
Applications: ELISA, WB
NB110-57586
Species: Bv, Ch, Hu, Mu, Pm, Rb, Rt
Applications: IHC,  IHC-P, KD, WB
NB100-56161
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
PAF-ST2
Species: Hu
Applications: IP, KO, WB
NBP1-89953
Species: Hu
Applications: IHC,  IHC-P
NBP3-12600
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB

Publications for Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01) (0)

There are no publications for Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01) (0)

There are no reviews for Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hsp70 interacting protein HIP Products

Research Areas for Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01)

Find related products by research area.

Blogs on Hsp70 interacting protein HIP

There are no specific blogs for Hsp70 interacting protein HIP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Hsp70 interacting protein HIP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ST13