Recombinant Human Hsp70 interacting protein HIP Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Hsp70 interacting protein HIP Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 21186 of Human ST13 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ST13
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Hsp70 interacting protein HIP Protein

  • AAG2
  • aging-associated protein 2
  • FAM10A1FAM10A4
  • heat shock 70kD protein binding protein
  • Hip
  • HIPFLJ27260
  • HOP
  • hsc70-interacting protein
  • Hsp70-interacting protein
  • HSPABP1
  • P48MGC129952
  • PRO0786
  • Progesterone receptor-associated p48 protein
  • Protein FAM10A1
  • Putative tumor suppressor ST13
  • Renal carcinoma antigen NY-REN-33
  • SNC6HSPABP
  • suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
  • suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein)
  • Suppression of tumorigenicity 13 protein

Background

The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37429
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-77316
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP
AF5629
Species: Hu, Mu
Applications: WB
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF2890
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP2-49581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP

Publications for Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01) (0)

There are no publications for Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01) (0)

There are no reviews for Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hsp70 interacting protein HIP Products

Bioinformatics Tool for Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01)

Discover related pathways, diseases and genes to Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01)

Discover more about diseases related to Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01).
 

Pathways for Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01)

View related products by pathway.

PTMs for Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01)

Learn more about PTMs related to Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01).
 

Research Areas for Hsp70 interacting protein HIP Recombinant Protein (H00006767-P01)

Find related products by research area.

Blogs on Hsp70 interacting protein HIP

There are no specific blogs for Hsp70 interacting protein HIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Hsp70 interacting protein HIP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ST13