Hsp70 interacting protein HIP Recombinant Protein Antigen

Images

 
There are currently no images for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-61615PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Hsp70 interacting protein HIP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ST13.

Source: E.coli

Amino Acid Sequence: EITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRA

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ST13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-61615. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Hsp70 interacting protein HIP Recombinant Protein Antigen

  • AAG2
  • aging-associated protein 2
  • FAM10A1FAM10A4
  • heat shock 70kD protein binding protein
  • Hip
  • HIPFLJ27260
  • HOP
  • hsc70-interacting protein
  • Hsp70-interacting protein
  • HSPABP1
  • P48MGC129952
  • PRO0786
  • Progesterone receptor-associated p48 protein
  • Protein FAM10A1
  • Putative tumor suppressor ST13
  • Renal carcinoma antigen NY-REN-33
  • SNC6HSPABP
  • suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
  • suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein)
  • Suppression of tumorigenicity 13 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-67509
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-75440
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-16991
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-38988
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-75686
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-48011
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67168
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-49581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP

Publications for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-61615PEP) (0)

There are no publications for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-61615PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-61615PEP) (0)

There are no reviews for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-61615PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-61615PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Hsp70 interacting protein HIP Products

Bioinformatics Tool for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-61615PEP)

Discover related pathways, diseases and genes to Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-61615PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-61615PEP)

Discover more about diseases related to Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-61615PEP).
 

Pathways for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-61615PEP)

View related products by pathway.

PTMs for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-61615PEP)

Learn more about PTMs related to Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-61615PEP).
 

Research Areas for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-61615PEP)

Find related products by research area.

Blogs on Hsp70 interacting protein HIP

There are no specific blogs for Hsp70 interacting protein HIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Hsp70 interacting protein HIP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ST13