Hsp70 interacting protein HIP Recombinant Protein Antigen

Images

 
There are currently no images for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-48865PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Hsp70 interacting protein HIP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Hsp70 interacting protein HIP.

Source: E. coli

Amino Acid Sequence: EITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ST13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48865.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Hsp70 interacting protein HIP Recombinant Protein Antigen

  • AAG2
  • aging-associated protein 2
  • FAM10A1FAM10A4
  • heat shock 70kD protein binding protein
  • Hip
  • HIPFLJ27260
  • HOP
  • hsc70-interacting protein
  • Hsp70-interacting protein
  • HSPABP1
  • P48MGC129952
  • PRO0786
  • Progesterone receptor-associated p48 protein
  • Protein FAM10A1
  • Putative tumor suppressor ST13
  • Renal carcinoma antigen NY-REN-33
  • SNC6HSPABP
  • suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
  • suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein)
  • Suppression of tumorigenicity 13 protein

Background

Hsp70 interacting protein HIP is encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-90267
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00010963-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NBP2-75440
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-16991
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB300-576
Species: Ch, Gp, Hu, Mu, Pm, Rb, Rt, Xp
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-03433
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF5110
Species: Mu
Applications: IHC, WB
H00007178-M06
Species: Hu, Mu, Rt
Applications: ELISA, WB
NB110-57586
Species: Bv, Ch, Hu, Mu, Pm, Rb, Rt
Applications: IHC,  IHC-P, KD, WB
NB100-56161
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
PAF-ST2
Species: Hu
Applications: IP, KO, WB
NBP1-89953
Species: Hu, Mu
Applications: IHC,  IHC-P
NBP3-12600
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB

Publications for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-48865PEP) (0)

There are no publications for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-48865PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-48865PEP) (0)

There are no reviews for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-48865PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-48865PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hsp70 interacting protein HIP Products

Research Areas for Hsp70 interacting protein HIP Recombinant Protein Antigen (NBP2-48865PEP)

Find related products by research area.

Blogs on Hsp70 interacting protein HIP

There are no specific blogs for Hsp70 interacting protein HIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Hsp70 interacting protein HIP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ST13