HSDL2 Antibody

Images

 
Western Blot: HSDL2 Antibody [NBP2-14105] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: HSDL2 Antibody [NBP2-14105] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: HSDL2 Antibody [NBP2-14105] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSDL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLGGPGIESQCRK VDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQP DFFL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSDL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000 - 1:2500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HSDL2 Protein (NBP2-14105PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HSDL2 Antibody

  • chromosome 9 open reading frame 99
  • EC 1.1.1
  • EC 1.1.1.100
  • FLJ25855
  • hydroxysteroid dehydrogenase like 2
  • member 1
  • MGC10940

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-44090
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-03030
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55940
Species: Hu
Applications: ICC/IF
NBP1-92455
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00140856-T01
Species: Hu
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HSDL2 Antibody (NBP2-14105) (0)

There are no publications for HSDL2 Antibody (NBP2-14105).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSDL2 Antibody (NBP2-14105) (0)

There are no reviews for HSDL2 Antibody (NBP2-14105). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSDL2 Antibody (NBP2-14105) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSDL2 Products

Bioinformatics Tool for HSDL2 Antibody (NBP2-14105)

Discover related pathways, diseases and genes to HSDL2 Antibody (NBP2-14105). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for HSDL2 Antibody (NBP2-14105)

View related products by pathway.

Research Areas for HSDL2 Antibody (NBP2-14105)

Find related products by research area.

Blogs on HSDL2

There are no specific blogs for HSDL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSDL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSDL2