HSDL2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HSDL2 Antibody [NBP2-14104] - Staining of human cell line RH-30 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HSDL2 Antibody [NBP2-14104] - Staining of human liver.
Immunohistochemistry-Paraffin: HSDL2 Antibody [NBP2-14104] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: HSDL2 Antibody [NBP2-14104] - Staining of human lymph node shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HSDL2 Antibody [NBP2-14104] - Staining in human adrenal gland and lymph node tissues using anti-HSDL2 antibody. Corresponding HSDL2 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: HSDL2 Antibody [NBP2-14104] - Staining of human colon, kidney, liver and lymph node using Anti-HSDL2 antibody NBP2-14104 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: HSDL2 Antibody [NBP2-14104] - Staining of human colon.
Immunohistochemistry-Paraffin: HSDL2 Antibody [NBP2-14104] - Staining of human kidney.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSDL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLKKSK VAHILNISPPLNLNPVWFKQHC
Specificity
Specificity of human HSDL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSDL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HSDL2 Protein (NBP2-14104PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HSDL2 Antibody

  • chromosome 9 open reading frame 99
  • EC 1.1.1
  • EC 1.1.1.100
  • FLJ25855
  • hydroxysteroid dehydrogenase like 2
  • member 1
  • MGC10940

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5759
Species: Hu, Mu
Applications: WB
NBP2-03030
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-85296
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94045
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-83997
Species: Hu
Applications: WB, IHC
NBP1-92455
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-08381
Species: Hu
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-14104
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for HSDL2 Antibody (NBP2-14104) (0)

There are no publications for HSDL2 Antibody (NBP2-14104).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSDL2 Antibody (NBP2-14104) (0)

There are no reviews for HSDL2 Antibody (NBP2-14104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HSDL2 Antibody (NBP2-14104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HSDL2 Products

Bioinformatics Tool for HSDL2 Antibody (NBP2-14104)

Discover related pathways, diseases and genes to HSDL2 Antibody (NBP2-14104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for HSDL2 Antibody (NBP2-14104)

View related products by pathway.

Research Areas for HSDL2 Antibody (NBP2-14104)

Find related products by research area.

Blogs on HSDL2

There are no specific blogs for HSDL2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSDL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSDL2