Histone H1.2 Antibody (9T9Q7)

Western Blot: Histone H1.2 Antibody (9T9Q7) [NBP3-15291] - Western blot analysis of extracts of various cell lines, using Histone H1.2 antibody (NBP3-15291) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunocytochemistry/Immunofluorescence: Histone H1.2 Antibody (9T9Q7) [NBP3-15291] - Immunofluorescence analysis of U-2 OS cells using Histone H1.2 Rabbit mAb (NBP3-15291) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Western Blot: Histone H1.2 Antibody (9T9Q7) [NBP3-15291] - Western blot analysis of extracts of various cell lines, using Histone H1.2 antibody (NBP3-15291) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.

Immunocytochemistry/ Immunofluorescence: Histone H1.2 Antibody (9T9Q7) [Histone H1.2] - Confocal imaging of U-2 OS cells using Histone H1.2 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 9T9Q7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Histone H1.2 Antibody (9T9Q7) Summary

• Description: Novus Biologicals Rabbit Histone H1.2 Antibody (9T9Q7) (NBP3-15291) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H1.2 (P16403). MSETAPAAPAAAPPAEKAPVKKKAAKKAGGTPRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTG
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: H1-2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:500
  • Western Blot 1:1000 - 1:5000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Histone H1.2 Antibody (9T9Q7)

• H1 histone family, member 2
• H1.2
• H1F2H1C
• histone 1, H1c
• histone cluster 1, H1c
• histone H1.2
• Histone H1d
• MGC3992

Background

Histones are nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber as they play a critical role in transcription regulation, DNA repair, DNA replication, and chromosomal stability. The Histone H1.2 protein is 213 amino acids long, 21 kDA and is encoded by the HIST1H1C gene. H1 proteins are essential in forming chromatin fiber and for the condensation of nucleosome chains into higher-order structured fibers. The HIST1H1C gene has been investigated in leukemia and parkinson's disease. It plays a role in apoptosis, PKA signaling, cell cycle chromosome condensation in prometaphase, and histone modification through interactions with various genes such as TONSL, NPM1, YWHAQ, EED, and ESR2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: H1-2