HIST1H2BK Antibody

Product Discontinued

HIST1H2BK Antibody Summary

• Immunogen: Synthetic peptide directed towards the N terminal of human HIST1H2BKThe immunogen for this antibody is HIST1H2BK. Peptide sequence KKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFER.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: H2BC12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:1000
• Application Notes: This is a rabbit polyclonal antibody against HIST1H2BK and was validated on Western blot.
• Theoretical MW: 14 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HIST1H2BK Antibody

• H2B histone family, member T
• H2B K
• H2B/S
• H2BFAiii
• H2BFT
• H2bk
• HIRA-interacting protein 1
• HIRIP1
• histone cluster 1, H2bk
• histone family member
• histone H2B type 1-K
• MGC131989

Background

HIST1H2BK is 126 amino acids long, weighs approximately 14 kDa, and the gene codes for a part of a group of basic nuclear proteins called histones, which are responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Current studies are being done on several diseases and disorders including systemic lupus erythematosus, lupus erythematosus, and immunodeficiency. HIST1H2BK has also been shown to have interactions with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H4E in pathways such as the telomere maintenance, nucleosome assembly, cell cycle, and systemic lupus erythematosus pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: H2BC12
• Uniprot:
  • NP_542160(Human)