HIST1H2BK Antibody


Western Blot: HIST1H2BK Antibody [NBP1-79872] - Human Fetal Liver Lysate 1ug/ml Gel Concentration 10-20%

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

HIST1H2BK Antibody Summary

Synthetic peptide directed towards the N terminal of human HIST1H2BKThe immunogen for this antibody is HIST1H2BK. Peptide sequence KKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFER.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against HIST1H2BK and was validated on Western blot.
Theoretical MW
14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
HIST1H2BK Lysate (NBP2-66078)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HIST1H2BK Antibody

  • H2B histone family, member T
  • H2B K
  • H2B/S
  • H2BFAiii
  • H2BFT
  • H2bk
  • HIRA-interacting protein 1
  • HIRIP1
  • histone cluster 1, H2bk
  • histone family member
  • histone H2B type 1-K
  • MGC131989


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, IHC-P
Species: Hu
Applications: WB, IHC

Publications for HIST1H2BK Antibody (NBP1-79872) (0)

There are no publications for HIST1H2BK Antibody (NBP1-79872).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIST1H2BK Antibody (NBP1-79872) (0)

There are no reviews for HIST1H2BK Antibody (NBP1-79872). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIST1H2BK Antibody (NBP1-79872) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for HIST1H2BK Antibody (NBP1-79872)

Discover related pathways, diseases and genes to HIST1H2BK Antibody (NBP1-79872). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HIST1H2BK

There are no specific blogs for HIST1H2BK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HIST1H2BK Antibody and receive a gift card or discount.


Gene Symbol HIST1H2BK