HIST1H2BK Antibody

Images

 
Western Blot: HIST1H2BK Antibody [NBP1-79872] - Human Fetal Liver Lysate 1ug/ml Gel Concentration 10-20%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HIST1H2BK Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human HIST1H2BKThe immunogen for this antibody is HIST1H2BK. Peptide sequence KKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFER.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HIST1H2BK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against HIST1H2BK and was validated on Western blot.
Theoretical MW
14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
HIST1H2BK Lysate (NBP2-66078)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HIST1H2BK Antibody

  • H2B histone family, member T
  • H2B K
  • H2B/S
  • H2BFAiii
  • H2BFT
  • H2bk
  • HIRA-interacting protein 1
  • HIRIP1
  • histone cluster 1, H2bk
  • histone family member
  • histone H2B type 1-K
  • MGC131989

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88644
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47871
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92094
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00054101-M01
Species: Hu
Applications: WB, ELISA
MAB8318
Species: Hu, Mu, Rt
Applications: WB, ICC
H00010210-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NBP1-86376
Species: Hu
Applications: IHC, IHC-P
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP2-01904
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for HIST1H2BK Antibody (NBP1-79872) (0)

There are no publications for HIST1H2BK Antibody (NBP1-79872).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIST1H2BK Antibody (NBP1-79872) (0)

There are no reviews for HIST1H2BK Antibody (NBP1-79872). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIST1H2BK Antibody (NBP1-79872) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HIST1H2BK Antibody (NBP1-79872)

Discover related pathways, diseases and genes to HIST1H2BK Antibody (NBP1-79872). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HIST1H2BK

There are no specific blogs for HIST1H2BK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HIST1H2BK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HIST1H2BK
Uniprot