HHIP-Like 2 Antibody

Images

 
Western Blot: HHIP-Like 2 Antibody [NBP2-83042] - Host: Rabbit. Target Name: HHIPL2. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, BvSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HHIP-Like 2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human HHIP-Like 2. Peptide sequence: PGKCKYKPVPVRTKSKRIPFRPLAKTVLDLLKEQSEKAARKSSSATLASG The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Bovine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
HHIPL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HHIP-Like 2 Antibody

  • Hedgehog Interacting Protein-Like 2
  • HHIP3
  • HHIPL2
  • HHIP-Like Protein 2
  • KIAA1822L
  • KIAA1822-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79777
Species: Hu
Applications: WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-52173
Species: Hu, Mu, Rt, Po, Bv
Applications: PEP-ELISA
AF1568
Species: Mu
Applications: WB
NBP2-27417
Species: Hu, Mu, Rt
Applications: WB
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-27110
Species: Hu, Mu, Rt, Pm
Applications: IHC, IHC-P
AF3600
Species: Hu
Applications: WB, ICC
NBP2-16818
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-27174
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00026508-M07
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-87563
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HHIP-Like 2 Antibody (NBP2-83042) (0)

There are no publications for HHIP-Like 2 Antibody (NBP2-83042).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HHIP-Like 2 Antibody (NBP2-83042) (0)

There are no reviews for HHIP-Like 2 Antibody (NBP2-83042). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HHIP-Like 2 Antibody (NBP2-83042) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HHIP-Like 2 Products

Bioinformatics Tool for HHIP-Like 2 Antibody (NBP2-83042)

Discover related pathways, diseases and genes to HHIP-Like 2 Antibody (NBP2-83042). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HHIP-Like 2 Antibody (NBP2-83042)

Discover more about diseases related to HHIP-Like 2 Antibody (NBP2-83042).
 

Pathways for HHIP-Like 2 Antibody (NBP2-83042)

View related products by pathway.

Blogs on HHIP-Like 2

There are no specific blogs for HHIP-Like 2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HHIP-Like 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HHIPL2