Recombinant Human HECTD2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HECTD2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 331 - 440 of Human HECTD2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HPPLIPYTDFYNSTLDHIDLMEEYHTWQNFGNSHRFSFCQYPFVISVAAKKIIIQRDSEQQMINIARQSLVDKVSRRQRPDMNILFLNMKVRRTHLVSDSLDELTRKRAD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HECTD2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HECTD2 Protein

  • EC 6.3.2.-
  • FLJ16050
  • FLJ37306
  • HECT domain containing 2
  • HECT domain-containing protein 2
  • probable E3 ubiquitin-protein ligase HECTD2

Background

HECTD2 - HECT domain containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-16429
Species: Hu
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86255
Species: Hu
Applications: IHC, IHC-P
NBP1-92431
Species: Hu
Applications: WB, IHC, IHC-P
H00079092-T01
Species: Hu
NBP1-49461
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, In vivo
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF1029
Species: Mu
Applications: WB, IHC, IP
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB500-240
Species: Hu, Mu
Applications: WB, IP

Publications for HECTD2 Partial Recombinant Protein (H00143279-Q01) (0)

There are no publications for HECTD2 Partial Recombinant Protein (H00143279-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HECTD2 Partial Recombinant Protein (H00143279-Q01) (0)

There are no reviews for HECTD2 Partial Recombinant Protein (H00143279-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HECTD2 Partial Recombinant Protein (H00143279-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HECTD2 Products

Bioinformatics Tool for HECTD2 Partial Recombinant Protein (H00143279-Q01)

Discover related pathways, diseases and genes to HECTD2 Partial Recombinant Protein (H00143279-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HECTD2 Partial Recombinant Protein (H00143279-Q01)

Discover more about diseases related to HECTD2 Partial Recombinant Protein (H00143279-Q01).
 

Pathways for HECTD2 Partial Recombinant Protein (H00143279-Q01)

View related products by pathway.

Blogs on HECTD2

There are no specific blogs for HECTD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HECTD2 Antibody
NBP1-83481

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HECTD2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HECTD2