Recombinant Human hCG beta 7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human hCG beta 7 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 56 - 165 of Human CGB7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CGB7

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human hCG beta 7 Protein

  • CGB3
  • CG-beta
  • CG-beta-a
  • Chorionic gonadotrophin chain beta
  • chorionic gonadotropin beta 7 subunit
  • chorionic gonadotropin, beta polypeptide 7
  • FLJ35403
  • FLJ43118

Background

CGB7 - chorionic gonadotropin, beta polypeptide 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22392
Species: Hu
Applications: WB, IHC-Fr, IHC-P
H00093659-T01
Species: Hu
NBP1-80782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF8016
Species: Hu
Applications: WB, IHC
H00114336-R01
Species: Hu
MAB4169
Species: Hu
Applications: WB, IHC
NBP1-83552
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-38648
Species: Hu
Applications: WB, IHC, IHC-P
H00094027-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for hCG beta 7 Partial Recombinant Protein (H00094027-Q01) (0)

There are no publications for hCG beta 7 Partial Recombinant Protein (H00094027-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hCG beta 7 Partial Recombinant Protein (H00094027-Q01) (0)

There are no reviews for hCG beta 7 Partial Recombinant Protein (H00094027-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for hCG beta 7 Partial Recombinant Protein (H00094027-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional hCG beta 7 Products

Bioinformatics Tool for hCG beta 7 Partial Recombinant Protein (H00094027-Q01)

Discover related pathways, diseases and genes to hCG beta 7 Partial Recombinant Protein (H00094027-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hCG beta 7 Partial Recombinant Protein (H00094027-Q01)

Discover more about diseases related to hCG beta 7 Partial Recombinant Protein (H00094027-Q01).
 

Pathways for hCG beta 7 Partial Recombinant Protein (H00094027-Q01)

View related products by pathway.

Research Areas for hCG beta 7 Partial Recombinant Protein (H00094027-Q01)

Find related products by research area.

Blogs on hCG beta 7

There are no specific blogs for hCG beta 7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD20 Antibody (AISB12)
NBP1-43435-0.1mg
EIF3M Antibody
NBP1-83552
PLOD1 Antibody
NBP2-38770

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human hCG beta 7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CGB7