H2A Antibody (4C10)

Images

 
Immunocytochemistry/ Immunofluorescence: H2A Antibody (4C10) [H00008337-M01] - Analysis of monoclonal antibody to HIST2H2AA3 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4C10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

H2A Antibody (4C10) Summary

Immunogen
HIST2H2AA (AAH01629, 1 a.a. ~ 130 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Specificity
HIST2H2AA - histone 2, H2aa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HIST2H2AA3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for H2A Antibody (4C10)

  • H2A histone family, member O
  • H2A.2
  • H2A/O
  • H2A/q
  • H2a-615
  • H2AFOHistone H2A/o
  • HIST2H2AAH2A
  • histone 2, H2aa
  • histone 2, H2aa3
  • histone cluster 2, H2aa3
  • histone H2A type 2-A
  • Histone H2A.2

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-07996
Species: Hu
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45184
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-67753
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-52095
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
AF2288
Species: Hu
Applications: WB, Simple Western, IHC, ICC

Publications for H2A Antibody (H00008337-M01) (0)

There are no publications for H2A Antibody (H00008337-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H2A Antibody (H00008337-M01) (0)

There are no reviews for H2A Antibody (H00008337-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for H2A Antibody (H00008337-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional H2A Products

Array H00008337-M01

Bioinformatics Tool for H2A Antibody (H00008337-M01)

Discover related pathways, diseases and genes to H2A Antibody (H00008337-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for H2A Antibody (H00008337-M01)

Discover more about diseases related to H2A Antibody (H00008337-M01).

Blogs on H2A.

H3.1t - A testis-specific histone variant
Histones are nuclear proteins essential for the storage and organization of genomic DNA as chromatin. Chromatin consists of DNA wrapped tightly around histone oligomers to form nucleosomes. In addition to compacting the genome, histones also regula...  Read full blog post.

H3.1 - A core histone essential for genome storage and organization
Histones are the main protein component of chromatin and are essential for the storage and compaction of the genome. DNA wraps around histone oligomers to make up nucleosomes, the individual subunits of chromatin. By altering the accessibility of t...  Read full blog post.

Histone H3
Eukaryotic chromosomes are formed through the highly organized and structural wrapping of DNA genetic material around histone proteins into the classic "bead on a string" globular structure of nucleosomes. The histone family consists of five family me...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our H2A Antibody (4C10) and receive a gift card or discount.

Bioinformatics

Gene Symbol HIST2H2AA3
Entrez
OMIM